PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7BL_9884A6FA5.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 70aa    MW: 8403.22 Da    PI: 5.861
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7BL_9884A6FA5.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1371.1e-112569145
                   FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeek 45
                           +fYn+YA e GFsvrks+ +    n+ i+ r+ +Cs++g+ree++
  Traes_7BL_9884A6FA5.1 25 EFYNKYALEKGFSVRKSYVEWDGSNKYIILRKIMCSRQGFREEKH 69
                           6****************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.9E-92569IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
ASDESMFEYX NVVSKMFDSE AEGYEFYNKY ALEKGFSVRK SYVEWDGSNK YIILRKIMCS  60
RQGFREEKHM
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-103HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751141.13e-25PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010231784.22e-24PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5FLZ02e-44W5FLZ0_WHEAT; Uncharacterized protein
TrEMBLW5HP992e-44W5HP99_WHEAT; Uncharacterized protein
STRINGBRADI2G37795.15e-24(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]